DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB8 and Spn28Dc

DIOPT Version :10

Sequence 1:NP_002631.3 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:68 Identity:18/68 - (26%)
Similarity:28/68 - (41%) Gaps:16/68 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     2 AFYSYNSFLAIFWTRLPG----HSVY--PSCSH-------FPSLAFLHLPDSHLRTAYIKNCGSR 53
            ||.....::.:|.|...|    |.::  .:|||       .|||:|..:......:..|   |.|
  Fly   122 AFKHAGLYVGLFGTLFMGAVCTHCMHMLVNCSHELCRRLQVPSLSFADVCQRAFESGPI---GLR 183

Human    54 KYS 56
            :||
  Fly   184 RYS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB8NP_002631.3 serpinB8_CAP-2 1..374 CDD:381033 18/68 (26%)
Spn28DcNP_609172.1 serpin28D-like_insects 111..532 CDD:381061 18/68 (26%)

Return to query results.
Submit another query.