DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINE2 and Spn42Dd

DIOPT Version :9

Sequence 1:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:390 Identity:117/390 - (30%)
Similarity:196/390 - (50%) Gaps:41/390 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    37 LSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKKQL------------ 89
            |.:..:...|..:::..:.||..:.|:|:||..|.::|.|:.:||:|.|.|:|            
  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKE 72

Human    90 AMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVN 154
            |:..|||.     :|..:.    .::...|:.:||.::|.:...:...:....::.|:.|..:::
  Fly    73 AVAARYGA-----LLNDLQ----GQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESIS 128

Human   155 FEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLT---RLVLVNAVYFKGLWKSRFQPENTKK 216
            ..:...|.:.||.||.::|...|..::.|    |.:|   :.:||||:||||.|:|:|.|..|:.
  Fly   129 LTNGPVAAERINQWVLDQTSGKIKGMIDP----GSMTSDVKALLVNAIYFKGQWESKFDPAKTRA 189

Human   217 RTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAII 281
            .||.....||..|.|:||:..||....   .||....|||||...::||.|.||.|.. .|||: 
  Fly   190 STFQVTANKSVPVQMMAQMGTFRANYF---RDLDAQVIELPYLNSNLSMTIFLPREVE-GLSAL- 249

Human   282 PHISTKTIDSWMSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENL 346
                .:.|..:...:|.|.|.:.||||....:.:|||.|:.|||.::| :.|::.:.:.......
  Fly   250 ----EEKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF-TDKSDLSGLFADKSGG 309

Human   347 HVSHILQKAKIEVSEDGTKASAATTAILIARSSPPWFIV-DRPFLFFIRHNPTGAVLFMGQINKP 410
            .||.:..||.:||:|:|.:|:.||:..:..|:....|:: |.||.|.||...|  :.|.|::..|
  Fly   310 KVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Human   411  410
              Fly   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINE2XP_005246698.1 None
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 115/377 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9820
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.