DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINE2 and Spn88Eb

DIOPT Version :9

Sequence 1:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:427 Identity:110/427 - (25%)
Similarity:194/427 - (45%) Gaps:50/427 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    17 LPLFLLASVTLPSICSHFNPLSLEELGS-NTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLG 80
            ||:..:|::..|.: |..|..|....|. :..:.:..||.:..|..|:..||....:.|.:....
  Fly    12 LPVVTIAALDKPEL-SFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFS 75

Human    81 ADGRTKKQLAMVMRYGVNGVGKILKKINKAIVS------------KKNKDIVTVANAVFVKNASE 133
            :..:|:::||..:     .:|..|.| .:.:||            :::...::.||.:||.....
  Fly    76 SSEQTERELAQAL-----NLGWALNK-QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTIN 134

Human   134 IEVPFVTRNKDVFQCEVRNVNFE-DPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVN 197
            :...|.|    :.....:.::|: ||.:....||.|:.::|.:.|.::||.:.|. ..|.|||.|
  Fly   135 VSNKFNT----LLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEIT-PHTMLVLAN 194

Human   198 AVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYH--- 259
            |.|.||.|.|:|:.|.|..:.|...:.:...|.|:.:...|:   .:....|....|:|||.   
  Fly   195 AAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFK---MTIDEGLQSQIIKLPYRTIY 256

Human   260 ------------GESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA 312
                        ...|||:|.||..:...|:.:|..::..::..|....:|:::::.||||....
  Fly   257 KSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQ 321

Human   313 QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTAILIAR 377
            :.:|...|.::|:..|| :..|.|..:|....:|.:......|||:|.|.|:.|:|| |.:|::|
  Fly   322 RLELTPILSLMGVNTMF-TRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAA-TILLVSR 384

Human   378 SS----PPWFIVDRPFLFFIRHNPTGAVLFMGQINKP 410
            ||    |..|..:.||:|.|.......:||.|..:.|
  Fly   385 SSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINE2XP_005246698.1 None
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 102/396 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.