DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB6 and nec

DIOPT Version :9

Sequence 1:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:378 Identity:114/378 - (30%)
Similarity:194/378 - (51%) Gaps:28/378 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    89 FALNLLKTLGKDNS-KNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQS 152
            |:..|.|.:.|..| :||.|||.|:...||::|..:.|.|..::.:...|:|:...  :.|.|:|
  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMA--VAQDFES 172

Human   153 LLT-EVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFY-QAEMEELDFISAVEKSRKHINTW 215
            ::. :.:..|..  |.:|.:::..:....::...|...||| .|..|.:|..:|.:.:.| ||.|
  Fly   173 VIKYKKHLEGAD--LTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAK-INAW 234

Human   216 VAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFK 280
            |.:.|..||.:|::|..|||.|:.:|||||||:|.|:.:|...:|....|:.:......|.|||.
  Fly   235 VMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFN 299

Human   281 QSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL-DMMDEEE 344
            ...:....:.|:....|.|.|.....:|:|:||:|||.|..:.::|:..:| :..|: ..:..:.
  Fly   300 DDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEF-DLNRVAHRLRRQS 363

Human   345 VEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAA 409
            |.|.||:|:.|...||...|:|||:...| ...:..:.:....:.:||::.|:::.|.|.||||:
  Fly   364 VAVRLPKFQFEFEQDMTEPLKNLGVHQMF-TPNSQVTKLMDQPVRVSKILQKAYINVGEAGTEAS 427

Human   410 AATAAIMMMRCARFVP--------RFCADHPFLFFIQHSKTNGILFCGRFSSP 454
            ||:       .|:|||        .|.|:.||:|.::...:  :||.|....|
  Fly   428 AAS-------YAKFVPLSLPPKPTEFVANRPFVFAVRTPAS--VLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 113/376 (30%)
necNP_524851.1 SERPIN 108..468 CDD:238101 113/373 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.