DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB6 and Spn88Eb

DIOPT Version :9

Sequence 1:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:399 Identity:121/399 - (30%)
Similarity:191/399 - (47%) Gaps:51/399 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    89 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQIL----SFNKSGGGGDIHQ 148
            |:|.|:|.:.: ..|.|:||||.|...||.:.|..:...|..::||.|    :.||         
  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK--------- 96

Human   149 GFQSLLTEVNKTGTQ---------YLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISA 204
              |.:|........|         ..|..|||:|.:::.:..:.|.   ...|.| .:||||.:.
  Fly    97 --QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGA-TKELDFKND 155

Human   205 VEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSK 269
            .|...|.||.|:|:||..:|.::||...:.|.|.|||.||.|.:|.|..||..|.|..:.|.:::
  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE 220

Human   270 NEEKPVQMMFKQSTFKKTYIGEIFTQILVLP----YVGKE-----------LNMIIMLPDET-TD 318
            .|::.|.||.|...||.|....:.:||:.||    |..||           ::|||:||:.. ..
  Fly   221 REQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285

Human   319 LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM 383
            |..|...|..:...:|  .:....:::|:|||:|:.|:..::..:|..:|:...| ...|.|..:
  Fly   286 LNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMF-TRNATFGDL 347

Human   384 SQTDLSL--SKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP-RFCADHPFLFFIQHSKTNGI 445
            :...:||  ....|.:.::|:|.|:.|||||..::.....:..| :|..:|||:|.|...|.:.|
  Fly   348 TADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTI 412

Human   446 LFCGRFSSP 454
            ||.|.:|.|
  Fly   413 LFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 120/397 (30%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 119/394 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.