DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB5 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:373 Identity:115/373 - (30%)
Similarity:189/373 - (50%) Gaps:31/373 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    14 DLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF--ENVKDVPFGFQTVTSD 76
            ::::.|.:.....|::.||:.:.|.||:..:||:|.||.|:...|..  |:.:.|...:..:.:|
  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLND 84

Human    77 VNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKG-----QINNSI 136
            :........|||..|:||:...:|:..:..:.:.|:..|.|::..      |.|     :||..:
  Fly    85 LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISL------TNGPVAAERINQWV 143

Human   137 KDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNME 201
            .|.|.|..:.::...|:....|.|:|||.||.|:|..||..::|:...|:|....:.|||||...
  Fly   144 LDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQM 208

Human   202 ATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMAN 266
            .||.......::.::||||:.|.:|||.|.||::||    ||..:|     |.:..:..|  :..
  Fly   209 GTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVE----GLSALE-----EKIVGFARP--LVA 262

Human   267 AKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGM-SETKGVALSNVIHKVCLEITEDG 330
            .:|.|.:||||:|...:.|..||.||::.:|: |.||.||: ::..|..:|.|.||..||:.|:|
  Fly   263 KEVYLKLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGKVSQVSHKAFLEVNEEG 326

Human   331 GDSIEVPGARILQH---KDELNADHPFIYIIRHNKTRNIIFFGKFCSP 375
            .::.......:...   ...|.|||||.::||...|  |.|.|:..||
  Fly   327 AEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 113/371 (30%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 113/368 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.