DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB5 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:398 Identity:100/398 - (25%)
Similarity:186/398 - (46%) Gaps:50/398 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    11 FAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFE---NVKDVPFGFQT 72
            |::.|.||:.|..|.||:.|||.....:|.||...:...|..|:.|.|:..   |.:.|...: |
  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSY-T 104

Human    73 VTSDVNKL---SSFYSLKLIKRLYVDKSLNLSTEF----ISSTKRPYAKELETVDFKDKLEETKG 130
            :....::.   .|...|....|::||:::|:|.:|    ..:||.        :|||:..|....
  Fly   105 LAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKE--------LDFKNDPETGLK 161

Human   131 QINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPV 195
            :||:.|.|.|.....::|:...:...|.:::.||||..|:|:.:|...||...||.:|:.:.:.|
  Fly   162 EINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMV 226

Human   196 QMMNMEATFCMGNIDSINCKIIELPFQ---------------NKHLSMFILLPKDVEDESTGLEK 245
            .||:....|.|...:.:..:||:||::               ...:||.|:||   ......|.:
  Fly   227 YMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---NSNKISLNR 288

Human   246 IEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSET 310
            :..:||::|:.:|...:  ...|::||:|||:.|:.::....|..:|:..:|:.:.:.....::.
  Fly   289 VISRLNADSVKKWFERA--LPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADP 351

Human   311 KGVALSNVIHKVCLEITEDGGDSIEVPGARIL------QHKD--ELNADHPFIYIIRHNKTRNII 367
            ..:.:.:..|...:::.|.|..:   ..|.||      :..|  :.|.:|||:::|...|...|:
  Fly   352 ISLVIDDAQHLAKIKVDEVGSTA---AAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTIL 413

Human   368 FFGKFCSP 375
            |.|.:..|
  Fly   414 FAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 99/396 (25%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 99/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.