DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA4 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:389 Identity:116/389 - (29%)
Similarity:172/389 - (44%) Gaps:65/389 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   100 YYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHT 164
            |.|::.....:|:..||:||....:|:.:||...:..::...||  |....:..|...:..||:.
  Fly    22 YQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALG--LPSEDKEAVAARYGALLND 84

Human   165 LNLPGHGLETRVGSALFLSHNLKFLAKFLND--------TMAVYEAKLFHTNFYDTVGTIQL--- 218
            |    .|.|.  |..|.|::.:     ::||        .:||.|.      |.....:|.|   
  Fly    85 L----QGQEE--GPILKLANRI-----YVNDQYSLNQNYNLAVREP------FKSEAESISLTNG 132

Human   219 ------INDHVKKETRGKIVDLV--SELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDEN 275
                  ||..|..:|.|||..::  ..:..||..:|||.||||..||..|..::|....|.|..|
  Fly   133 PVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTAN 197

Human   276 TTVRVPMMLQDQEHHW-YLHDRYLPCSVLRMDY-KGDATVFFILPNQGKMREIEEV-LTPEMLMR 337
            .:|.|.||.|...... |..|  |...|:.:.| ..:.::...||     ||:|.: ...|.::.
  Fly   198 KSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIVG 255

Human   338 WNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGI-TKQQKLEASKSFH 401
            :...|..:..|    |.||||.|.....|.:.|.:||..:||:..:||||: ..:...:.|:..|
  Fly   256 FARPLVAKEVY----LKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSH 316

Human   402 KATLDVDEAGTEAAAATSFAIKFFSAQTNR----HILRFNRPFLVVIFSTSTQSVLFLGKVVDP 461
            ||.|:|:|.|.|||.|||.|:      |||    ..|..:.||..||...:|  :.|.|:||.|
  Fly   317 KAFLEVNEEGAEAAGATSVAV------TNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 113/384 (29%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 113/384 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.