DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA1 and nec

DIOPT Version :9

Sequence 1:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:404 Identity:110/404 - (27%)
Similarity:192/404 - (47%) Gaps:40/404 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    36 DTSHHDQDHPTFNKITP---NLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTH 97
            |.:..:...|..|:..|   .:..|:..|::::....:..|:.|||.|:....|::...:...|.
  Fly    86 DLTKREPVTPPPNRPPPVFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTF 150

Human    98 DEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLY 162
            .|:.:...|:...:..||..|...:..:.|...|    ||....::.:..|..|:...::..|.|
  Fly   151 RELQKAGEFSKNAMAVAQDFESVIKYKKHLEGAD----LTLATKVYYNRELGGVNHSYDEYAKFY 211

Human   163 HS---EAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLV--KELDRDTVFALVNYIFFKGKWERPF 222
            .|   ||  |:..:.::...:||.:|...|:.||.|||  .::|..|...|||.::|:|:||..|
  Fly   212 FSAGTEA--VDMQNAKDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEF 274

Human   223 EVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATA-IFFLPDE----G 282
            ...||...||........||.||....::.:....:|.:..|.:.|..:||: :..||:|    |
  Fly   275 ATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLG 339

Human   283 K-LQHLE------NELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGA 340
            | ||.|.      |.:.|.:        .|:|.::.|||.......|:...|..||:.::|:..:
  Fly   340 KMLQQLSRPEFDLNRVAHRL--------RRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNS 396

Human   341 DLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPP---EVKFNKPFVFLMIEQN 402
            .::.:.:: |:::||.:.||.:.:.|.||||:.|.:.:.:|:|:||   |...|:||||.:  :.
  Fly   397 QVTKLMDQ-PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RT 458

Human   403 TKSPLFMGKVVNPT 416
            ..|.||:|.|..||
  Fly   459 PASVLFIGHVEYPT 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 103/376 (27%)
RCL 368..392 10/26 (38%)
necNP_524851.1 SERPIN 108..468 CDD:238101 103/376 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7631
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.