DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA1 and Spn43Ad

DIOPT Version :10

Sequence 1:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens
Sequence 2:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster


Alignment Length:194 Identity:41/194 - (21%)
Similarity:64/194 - (32%) Gaps:74/194 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    12 TAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQ-------KY---------- 59
            |..||..:|....|  .|.||::|  .:.|:...:.:|:||...|.       |:          
  Fly   181 TRHGNETQLLRFKP--AFREDIES--NRLGSMPCEELLRKLQPPYWFAAHLHCKFAALVEHPGER 241

Human    60 --KFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKV 122
              ||:.|:....|||.          |:||.....:.|.....:.                    
  Fly   242 CTKFLALDKCLPKRRF----------LQILDIPTAEDEDGGEAKP-------------------- 276

Human   123 CLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFL--------RDQFTTTEVNMARV 178
                   |.|:||::....|   ||   |.:|.|:.....::        |..||.:|...|:|
  Fly   277 -------VQLKYDLEWLTVL---NL---TNHLISIRTTNGYMPGEGGGGERFNFTPSEEEKAKV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA1NP_000286.3 serpinA1_A1AT 50..417 CDD:381012 30/156 (19%)
RCL 368..392
Spn43AdNP_610261.1 serpin42Dd-like_insects 34..407 CDD:381070 41/194 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.