| Sequence 1: | NP_000286.3 | Gene: | SERPINA1 / 5265 | HGNCID: | 8941 | Length: | 418 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610245.2 | Gene: | Spn42Dc / 35600 | FlyBaseID: | FBgn0033113 | Length: | 403 | Species: | Drosophila melanogaster |
| Alignment Length: | 34 | Identity: | 10/34 - (29%) |
|---|---|---|---|
| Similarity: | 14/34 - (41%) | Gaps: | 9/34 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Human 11 ETAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNET 44 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SERPINA1 | NP_000286.3 | serpinA1_A1AT | 50..417 | CDD:381012 | |
| RCL | 368..392 | ||||
| Spn42Dc | NP_610245.2 | serpin42Dd-like_insects | 7..380 | CDD:381070 | |
| Blue background indicates that the domain is not in the aligned region. | |||||