DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA1 and Spn42Dc

DIOPT Version :10

Sequence 1:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens
Sequence 2:NP_610245.2 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster


Alignment Length:34 Identity:10/34 - (29%)
Similarity:14/34 - (41%) Gaps:9/34 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    11 ETAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNET 44
            :||..||......:|     .|.::    |||.|
  Fly   419 QTADSNGPSSSPSLP-----NDTNT----PGNGT 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA1NP_000286.3 serpinA1_A1AT 50..417 CDD:381012
RCL 368..392
Spn42DcNP_610245.2 serpin42Dd-like_insects 7..380 CDD:381070
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.