DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcn3 and CG31650

DIOPT Version :9

Sequence 1:NP_001341974.1 Gene:Rcn3 / 52377 MGIID:1277122 Length:328 Species:Mus musculus
Sequence 2:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster


Alignment Length:306 Identity:109/306 - (35%)
Similarity:167/306 - (54%) Gaps:24/306 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    31 QDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGR-DVAKEFDKLSPEESQARLGRIVDRMDLAGDSD 94
            :|..|||        :|...|.::||||.:|. ..|:|||.|||:||:.||..::..|||  :.|
  Fly    53 RDAHHHG--------EDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDL--NKD 107

Mouse    95 GWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFH----DV 155
            .::...||:|||..:.::...:..:..:...|.|.|.|:.|:|....||...:  |:|.    |.
  Fly   108 EFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMED--EDFKKETIDY 170

Mouse   156 EDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYV 220
            :..|..:||:.:|:..|..||.:.|.:.|.||...|.:|||.|.|..|::..|::|.|.:.||.:
  Fly   171 DSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKI 235

Mouse   221 QVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHL 285
            ..:|::.|..|....|    |:.||:::|.:..|.|.||.|.|.||..|::|.:......|.:||
  Fly   236 NFQEFVGDAASHHDKE----WLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHL 296

Mouse   286 LHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTR-HH--DEL 328
            ...:|.|.|.|||..|||:|::.||||:||:||:.|.. :|  |||
  Fly   297 FVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcn3NP_001341974.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..48 4/16 (25%)
EFh_CREC_RCN3 44..311 CDD:320028 93/271 (34%)
EF-hand motif 44..73 CDD:320028 12/29 (41%)
EF-hand motif 79..110 CDD:320028 11/30 (37%)
EF-hand motif 117..146 CDD:320028 8/28 (29%)
EF-hand motif 167..196 CDD:320028 10/28 (36%)
EF-hand motif 204..233 CDD:320028 8/28 (29%)
EF-hand motif 245..274 CDD:320028 12/28 (43%)
EF-hand motif 281..311 CDD:320028 14/29 (48%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 325..328 2/4 (50%)
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 15/54 (28%)
EFh 100..153 CDD:298682 15/54 (28%)
EF-hand_7 184..241 CDD:290234 20/56 (36%)
EFh 184..241 CDD:298682 20/56 (36%)
EFh 228..281 CDD:298682 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.