DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGC and CG6508

DIOPT Version :9

Sequence 1:NP_002621.1 Gene:PGC / 5225 HGNCID:8890 Length:388 Species:Homo sapiens
Sequence 2:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster


Alignment Length:405 Identity:154/405 - (38%)
Similarity:226/405 - (55%) Gaps:48/405 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     4 MVVVLVCLQLLEAAV-------VKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGD--L 59
            ::::.:.|.||:.::       :...:.:.|:......||.||           |.||...|  .
  Fly     6 LIIIPLFLLLLDHSMGQLRRTPITRQINQNKTHANVKAEKILL-----------AAKYFLVDRQS 59

Human    60 SVTYEPMAY-MDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQS--QACTSHSRFNPSESS 121
            |.|.:.:|. .:..|...:.||||||.|.:.||||||:||||||.|.|  :||..|:::|.|.||
  Fly    60 SQTTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASS 124

Human   122 TYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPA 186
            ::..:|:.||:|||||||:||...||:.:..:.:.||.|..:.:|||:.||...||||:|:|:.:
  Fly   125 SHVEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFAS 189

Human   187 LSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGS-SGGAVVFGGVDSSLYTGQIYWAPVTQELYW 250
            :| ...||....::::|.:..|||||||.....| |||.|::||:|.|:|.|.|.:.||:...||
  Fly   190 IS-GGVTTPFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYW 253

Human   251 Q-----IGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQEDEYGQFLVNC 310
            |     :.||..|:       |: |||||.||||||:.||.:...|:.:...|.:...|:..|:|
  Fly   254 QFTANSVKIEGILL-------CN-GCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDC 310

Human   311 NSIQNLPSLTFIINGVEFPLPPSSYIL-----SNNGYCTVGVEPTYLSSQNGQPLWILGDVFLRS 370
            :|:..||::...|.|..:.|.|..||.     :|...|..|.  |||   .|..||||||:||..
  Fly   311 SSLCRLPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGF--TYL---QGNLLWILGDIFLGK 370

Human   371 YYSVYDLGNNRVGFA 385
            .|:|:|:|..|:|||
  Fly   371 VYTVFDVGKERIGFA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGCNP_002621.1 A1_Propeptide 18..46 CDD:285240 5/34 (15%)
gastricsin 70..387 CDD:133144 139/329 (42%)
Asp 72..387 CDD:278455 139/327 (43%)
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 139/332 (42%)
Asp 73..387 CDD:278455 139/327 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151474
Domainoid 1 1.000 297 1.000 Domainoid score I1463
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2536
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.