DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm34 and eIF4B

DIOPT Version :9

Sequence 1:NP_766350.2 Gene:Rbm34 / 52202 MGIID:1098653 Length:442 Species:Mus musculus
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:87 Identity:28/87 - (32%)
Similarity:50/87 - (57%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse   294 FVGNLPYKIEDSALEEHFLDCGSIVAVRIVR-NPLTGVGRGFGYVLFEN-TDAVHLALKLNNSEL 356
            ::.|||:...:..|.| |.:..:::::|:.| :...|..||||||..|| .|.:|: |.|.:..:
  Fly    83 YINNLPFDANEDDLYE-FFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHV-LSLPDPSI 145

Mouse   357 MGRKLRVMRSVNKEKLKQQNSN 378
            .||::|:..|...::..:|.||
  Fly   146 KGRRIRIELSNENDQQSRQKSN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbm34NP_766350.2 RRM1_RBM34 189..280 CDD:240840
RRM2_RBM34 292..364 CDD:240841 24/71 (34%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 28/87 (32%)
RRM_eIF4B 79..155 CDD:240848 24/73 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.