DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5PF and ATPsynCF6

DIOPT Version :9

Sequence 1:NP_001003701.1 Gene:ATP5PF / 522 HGNCID:847 Length:116 Species:Homo sapiens
Sequence 2:NP_001247264.1 Gene:ATPsynCF6 / 42759 FlyBaseID:FBgn0016119 Length:106 Species:Drosophila melanogaster


Alignment Length:112 Identity:46/112 - (41%)
Similarity:69/112 - (61%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     9 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP-VDAS 72
            |:.|.|.....|:|:    ..|||.|:.|.|.||..||||:||:||:||||.|  ::||. ||::
  Fly     1 MLSQSLLSGMRVLRT----EARRNFGIVAPALNKASDPIQQLFLDKVREYKQK--SAGGKLVDSN 59

Human    73 SEYQQELERELFKLKQMFGN---ADMNTFPTFKFEDPKFE-VIEKPQ 115
            .:.::||:.||.::.:.||:   .||..||.|:|.|.|.: :.:.||
  Fly    60 PDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVKVDPITQAPQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5PFNP_001003701.1 ATP-synt_F6 9..104 CDD:283226 41/98 (42%)
ATPsynCF6NP_001247264.1 ATP-synt_F6 11..94 CDD:283226 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147147
Domainoid 1 1.000 71 1.000 Domainoid score I9505
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5274
Isobase 1 0.950 - 0 Normalized mean entropy S6548
OMA 1 1.010 - - QHG48138
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - otm40856
orthoMCL 1 0.900 - - OOG6_107026
Panther 1 1.100 - - LDO PTHR12441
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.