DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK14 and Cdk4

DIOPT Version :9

Sequence 1:NP_001274064.1 Gene:CDK14 / 5218 HGNCID:8883 Length:469 Species:Homo sapiens
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:335 Identity:130/335 - (38%)
Similarity:183/335 - (54%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   115 VRRHSSPSSPTSPKFGKAD--SYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQ-EEEGTPF 176
            ||:........:.|||..|  :|::|..:|||:|.|||:.:..:.|.:||||.:|:. .|.|.|.
  Fly     4 VRQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPM 68

Human   177 TAIREASLLKGL---KHANIVLLHDIIHTKE-----TLTLVFEYVHTDLCQYMDKHP-GGLHPDN 232
            :.:||.||||.|   .|||||.|:::....|     .:.||||:|..||...:|:.| .|:.|..
  Fly    69 STLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPT 133

Human   233 VKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNE------ 291
            ::....:||.|:.::|...|:||||||||||:|..|.||:||||||:       ||.:|      
  Fly   134 IQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK-------TYGSEMKLTSV 191

Human   292 VVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDT 356
            |||||||.|:||| :..|::.:|:|...||..||....|.|||..: ::||:|||.:.|.|.|..
  Fly   192 VVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSE-KNQLDRIFELTGRPTEQQ 254

Human   357 WPGVHS--LPHF------KPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAA 413
            ||...|  |.||      :|:.|..:..|             :|:||.:|:|......|.||.|.
  Fly   255 WPQTISVALEHFPQRHPKRPKDFCPHLCK-------------YADDLLNKMLSYDLHLRPSALAC 306

Human   414 LSHEYFSDLP 423
            |.|:||...|
  Fly   307 LEHDYFQQEP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK14NP_001274064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..133 5/17 (29%)
STKc_PFTAIRE1 129..431 CDD:143374 127/321 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..469
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 121/307 (39%)
S_TKc 26..312 CDD:214567 121/307 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.