DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PFN1 and chic

DIOPT Version :10

Sequence 1:NP_001362920.1 Gene:PFN1 / 5216 HGNCID:8881 Length:181 Species:Homo sapiens
Sequence 2:NP_477016.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster


Alignment Length:92 Identity:26/92 - (28%)
Similarity:39/92 - (42%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     4 WNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLV-GKD-RSSFYVNGLTL 66
            |..|:||.:....|...|.:...|. ::||...|   ..:|..|:..|: |.| :.....||:||
  Fly     3 WQDYVDNQLLASQCVTKACIAGHDG-NIWAQSSG---FEVTKEELSKLISGFDQQDGLTSNGVTL 63

Human    67 GGQKC-------SVIRDSLLQDGEFSM 86
            .||:.       .|:|..|.:.|...|
  Fly    64 AGQRYIYLSGTDRVVRAKLGRSGVHCM 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PFN1NP_001362920.1 PROF 2..>106 CDD:214646 26/92 (28%)
chicNP_477016.1 Profilin 1..122 CDD:459724 26/92 (28%)

Return to query results.
Submit another query.