DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEX10 and elfless

DIOPT Version :10

Sequence 1:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens
Sequence 2:NP_609860.2 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster


Alignment Length:221 Identity:44/221 - (19%)
Similarity:60/221 - (27%) Gaps:109/221 - (49%)


- Green bases have known domain annotations that are detailed below.


Human   222 RVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHR------------- 273
            ||.|||....|:.:|.||..::         |||:..||....:....|:|.             
  Fly    18 RVISLPFSRNRSHLSSRLSYLV---------GLQMENFRTSNNSGVSQRIHNTGPTPVLAPSGLR 73

Human   274 -----GLSHRR---------ASLEERAVSRNPL-------------------------------- 292
                 |.|.|.         :|...|::.|.|.                                
  Fly    74 SRLLSGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSST 138

Human   293 ---------------------------------------CTLCLEERRH--PTATPCGHLFCWEC 316
                                                   |.:|||:.|.  |.:|.|||:||..|
  Fly   139 ESSTPMGHTESSDSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFCKAC 203

Human   317 ITAWCSSKAECPLCREKFPPQKLIYL 342
            |.....:...||||....|....|:|
  Fly   204 IKRAVDTGRVCPLCGVDEPEFHRIFL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:398431 14/40 (35%)
RING-HC_PEX10 293..342 CDD:438190 20/50 (40%)
elflessNP_609860.2 RING_Ubox 176..>215 CDD:473075 14/38 (37%)

Return to query results.
Submit another query.