DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEX10 and C32D5.11

DIOPT Version :10

Sequence 1:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens
Sequence 2:NP_001364718.1 Gene:C32D5.11 / 174052 WormBaseID:WBGene00016318 Length:728 Species:Caenorhabditis elegans


Alignment Length:78 Identity:28/78 - (35%)
Similarity:38/78 - (48%) Gaps:19/78 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   288 SRNPL----CTLCLEER--RHPTATPCGHLFCWECITAW-CSS-KAECPLCRE-------KFPPQ 337
            |.||:    ||:||..|  :......|.|.||:.||:.| |.| :..||:||:       .|..|
 Worm    17 SNNPVEELQCTICLSTRFSQECRIEGCNHSFCFSCISEWVCQSLRPSCPMCRKDVDKVSYDFSEQ 81

Human   338 KL----IYLRHYR 346
            ||    |.::.||
 Worm    82 KLGQKEIAIKEYR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:398431
RING-HC_PEX10 293..342 CDD:438190 23/63 (37%)
C32D5.11NP_001364718.1 RAD18 24..>114 CDD:227719 25/71 (35%)
RING_Ubox 26..68 CDD:473075 16/41 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.