DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEX10 and CG43058

DIOPT Version :10

Sequence 1:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens
Sequence 2:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster


Alignment Length:55 Identity:23/55 - (41%)
Similarity:35/55 - (63%) Gaps:4/55 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   292 LCTLCLE--ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKL--IYL 342
            :|.:|:|  .||.|.||||||:||::||........:||:|.:|...::|  |:|
  Fly    46 MCPICMENVRRRQPAATPCGHVFCYDCIQKAIGDYKKCPMCNKKIMYKQLTRIFL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:398431
RING-HC_PEX10 293..342 CDD:438190 22/52 (42%)
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.