DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5MC3 and Vha16-1

DIOPT Version :9

Sequence 1:NP_001002258.1 Gene:ATP5MC3 / 518 HGNCID:843 Length:142 Species:Homo sapiens
Sequence 2:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster


Alignment Length:65 Identity:25/65 - (38%)
Similarity:36/65 - (55%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    76 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 138
            :|||.| ||.:|..||  ||.|..:.:.|.|:.|    :||...||....:|.:||:.|:||..:
  Fly    97 LGAGLA-VGFSGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156

Human   139  138
              Fly   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5MC3NP_001002258.1 ATP9 68..142 CDD:164765 25/65 (38%)
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 12/25 (48%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.