DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5MC3 and VhaPPA1-2

DIOPT Version :9

Sequence 1:NP_001002258.1 Gene:ATP5MC3 / 518 HGNCID:843 Length:142 Species:Homo sapiens
Sequence 2:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster


Alignment Length:158 Identity:37/158 - (23%)
Similarity:58/158 - (36%) Gaps:45/158 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     7 LACTPSLIRAGSRVAYRPISASV----LSRPEASRTGEGSTVF---------------NGAQNGV 52
            |||..|::.|.|.:..  |..||    :..|........|.:|               :|..|..
  Fly    60 LACALSVLGAASGIYM--IGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKF 122

Human    53 SQLIQREFQTSAISRDIDTAAKFIGAG----------AATVGVAGSGAGIGTVFGSLIIGYARNP 107
            |. ::....::.::.::.|.....|||          ...||:.||||.:..         |.|.
  Fly   123 SS-VRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALAD---------AANS 177

Human   108 SLKQQLFSYAILGFALSEAMGLFCLMVA 135
            :|..::....|.|    .|:|||.|:||
  Fly   178 ALFVKILIVEIFG----SAIGLFGLIVA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5MC3NP_001002258.1 ATP9 68..142 CDD:164765 22/78 (28%)
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 21/108 (19%)
ATP-synt_C 143..204 CDD:278563 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.