DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5MC3 and Vha16-2

DIOPT Version :9

Sequence 1:NP_001002258.1 Gene:ATP5MC3 / 518 HGNCID:843 Length:142 Species:Homo sapiens
Sequence 2:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster


Alignment Length:148 Identity:37/148 - (25%)
Similarity:60/148 - (40%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     7 LACTPSLIRA---------GSRVAYRPISASVLSRPEASRTGEGSTVFNG--AQNG--VSQLIQR 58
            |.||.:.:..         |:.|:...|:...::||:.........|..|  |..|  ||.||  
  Fly    16 LGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVVSVLI-- 78

Human    59 EFQTSAISRDIDTAAKFIGAGAA-TVGVAG--SGAGIGTVFGSLIIGYARNPSLKQQLFSYAILG 120
               ..:|..|......::..||. :||:.|  :|..||....:.:.|.|..|    :||...:|.
  Fly    79 ---AGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQP----RLFVGMVLI 136

Human   121 FALSEAMGLFCLMVAFLI 138
            ...:|.:.|:.|:||..:
  Fly   137 LIFAEVLALYGLIVAIYL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5MC3NP_001002258.1 ATP9 68..142 CDD:164765 20/74 (27%)
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 37/148 (25%)
ATP-synt_C 15..120 CDD:294318 26/108 (24%)
ATP-synt_C 94..154 CDD:278563 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.