DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5MC3 and Vha16-5

DIOPT Version :9

Sequence 1:NP_001002258.1 Gene:ATP5MC3 / 518 HGNCID:843 Length:142 Species:Homo sapiens
Sequence 2:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster


Alignment Length:135 Identity:35/135 - (25%)
Similarity:56/135 - (41%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    17 GSRVAYRPISASVLSRPEASRTGEGSTVFNG--AQNG--VSQLIQREFQTSAISRDIDTAAKFIG 77
            |:.|:...|:|:.:.|||.........|..|  |..|  ||.|         :|.::..|.|:  
  Fly    66 GTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSVL---------LSGELAPAPKY-- 119

Human    78 AGAATVGVAGSGAGIGTVFGSLIIGYA---------RNPSLKQQLFSYAILGFALSEAMGLFCLM 133
              :...|.....||:...|..|..|||         |:.:|:.:||...||....:|.:||:.|:
  Fly   120 --SLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILILIFAEVLGLYGLI 182

Human   134 VAFLI 138
            :...:
  Fly   183 IGIYL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5MC3NP_001002258.1 ATP9 68..142 CDD:164765 20/80 (25%)
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 25/99 (25%)
ATP-synt_C 127..187 CDD:278563 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.