DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K20 and CG8173

DIOPT Version :9

Sequence 1:NP_057737.2 Gene:MAP3K20 / 51776 HGNCID:17797 Length:800 Species:Homo sapiens
Sequence 2:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster


Alignment Length:371 Identity:100/371 - (26%)
Similarity:150/371 - (40%) Gaps:56/371 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    25 GSFGSVYRAKWISQDKEVAVKKLL--KIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTE---- 83
            |...|.:..|.|:|:..|....|.  :|..||:||..|.|.||:.|.|||..  :.||.|.    
  Fly    52 GEIRSPWAVKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITN--DEGINTLALEM 114

Human    84 -YASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAAD-GV 146
             ..||||:.:..:......:...|......|||:.:.:||.||  .::|.||||.||::..: .:
  Fly   115 CTTSLGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEA--HLMHGDLKSFNVLVKGEFEI 177

Human   147 LKICDFGASRFHNHTTHMSL--------VGTFPWMAPEVIQSLPVSET-CDTYSYGVVLWEMLTR 202
            .|:||||.|...:....::.        |||..|.|||||..:.|.:: .|.:|:|:|::|.|..
  Fly   178 CKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETLAL 242

Human   203 EVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDT 267
             ||...||      |.....|.:......|....:|  ||.:.|             ..|..|..
  Fly   243 -VPPHTLE------LDAALGEDMDSSHDLPTDTDKL--QCKQLD-------------FSSDENKN 285

Human   268 SLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLP 332
            .||........|......:.|...|..::.|.| ..::.:.||.:..........:.....|.||
  Fly   286 GLPSAMEEHTDNDMSQDYDEEDDEEEKEEEEED-DEEDDDTKENDISYFTLNNLHSAYGTRPPLP 349

Human   333 -SFEIGAWTEDDVYCWVQQL-----VRKGDSSAEMSVYASLFKENN 372
             :|::    .||..|.|:..     ....|..|..:::..|  |||
  Fly   350 VAFQL----SDDYNCVVELFYLCTNALSEDRPAAKTIWQCL--ENN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K20NP_057737.2 STKc_MLTK 22..263 CDD:270962 75/254 (30%)
STYKc 23..260 CDD:214568 75/251 (30%)
Leucine-zipper 287..308 4/20 (20%)
SAM_MLTK 338..408 CDD:188928 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..800
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 98/369 (27%)
S_TKc 30..>245 CDD:214567 65/197 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43289
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.