DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINF1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:431 Identity:102/431 - (23%)
Similarity:186/431 - (43%) Gaps:68/431 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    33 PDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAE 97
            |..|.|.:::.:..|....:::.....:|...|.:......|:.|:..||.|...||......:.
  Fly    13 PVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSS 77

Human    98 QRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQK-----------NLKSASRIVFEKKLRIK 151
            ::||..:.:||......:.      :::|.:.|..|:           .|.||:||..::.:.:.
  Fly    78 EQTERELAQALNLGWALNK------QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVS 136

Human   152 SSFVAPLEKSYG-TRPRVLTGNPRLDLQEINNWV----QAQMKGKLARSTKEIPDEISILLLGVA 211
            :.|...|   || |:......:|...|:|||:|:    ..|::..|  |::||.....::|...|
  Fly   137 NKFNTLL---YGATKELDFKNDPETGLKEINDWIADKTHNQIRDML--SSEEITPHTMLVLANAA 196

Human   212 HFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPL-------- 268
            :.||||:::|...:|:|:.|:::|.....|.||....| .:..:|..|..:|.:||.        
  Fly   197 YMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGA-FKMTIDEGLQSQIIKLPYRTIYKSKE 260

Human   269 --------TGSMSIIFFLP--LKVTQNLT---LIEESLTSEFIHDIDRELKTVQAVLTVPKLKLS 320
                    ...:|:|..||  .|::.|..   |..:|:...|...:.::::     |::||.:..
  Fly   261 THISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIE-----LSLPKFQFE 320

Human   321 YEGEVTKSLQEMKLQSLFD-SPDFSKITGKPIKLT--QVEHRAGFEWNEDGAGTTPSPGL----- 377
            ...|:|..|..|.:.::|. :..|..:|..||.|.  ..:|.|..:.:|.|:....:..|     
  Fly   321 QRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRS 385

Human   378 --QPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPR 416
              ||.    |..::.|.||:|::.|.....:||.|...|||
  Fly   386 SRQPD----PTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39 2/5 (40%)
PEDF 40..415 CDD:239007 96/421 (23%)
O-glycosylated at one site 371..383 3/18 (17%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/401 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.