DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WWOX and yki

DIOPT Version :10

Sequence 1:NP_057457.1 Gene:WWOX / 51741 HGNCID:12799 Length:414 Species:Homo sapiens
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:111 Identity:40/111 - (36%)
Similarity:58/111 - (52%) Gaps:30/111 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    18 LPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKR-------------------------VA- 56
            ||||||:..|.||.:||.|||.:.||||.|:...|::                         :| 
  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330

Human    57 --GDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL--AFTVDDNP 98
              |.||.||||...|:|.::|::||::.|::.|||:  ..:|.|.|
  Fly   331 NLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WWOXNP_057457.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/4 (100%)
WW 18..47 CDD:459800 18/28 (64%)
Nuclear localization signal. /evidence=ECO:0000250 50..55 1/29 (3%)
WW 60..90 CDD:238122 13/29 (45%)
human_WWOX_like_SDR_c-like 124..407 CDD:187669
Interaction with MAPT. /evidence=ECO:0000250 125..414
Mediates targeting to the mitochondria. /evidence=ECO:0000250 209..273
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 40/111 (36%)
WW 266..295 CDD:459800 18/28 (64%)
WW 335..364 CDD:459800 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.