DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WWOX and Rdh1

DIOPT Version :10

Sequence 1:NP_057457.1 Gene:WWOX / 51741 HGNCID:12799 Length:414 Species:Homo sapiens
Sequence 2:NP_610310.2 Gene:Rdh1 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:304 Identity:125/304 - (41%)
Similarity:178/304 - (58%) Gaps:27/304 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   115 EILQGRDF------TGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWH 173
            |.:||..|      ||||.:|||||:|||.|||...|..|..|.||||:|.|..:|...|::|.:
  Fly    28 EYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETN 92

Human   174 KAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFY 238
            ...:.:..|||:.|.|::.|.:.||.:...||||:.||.....|.:|||||.|....|||:|||.
  Fly    93 NQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFL 157

Human   239 LVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILF 303
            |..||.|||..|||:|::||||.:|       :.|.::.:.|:..|: |...|||::|||.|:||
  Fly   158 LTNLLLDVLKNSAPSRIVVVSSLAH-------ARGSINVADLNSEKS-YDEGLAYSQSKLANVLF 214

Human   304 SNELHRRLSPRGVTSNAVHPGNMMYSNIHRSW------WVYTLLFTLARPFTKSMQQGAATTVYC 362
            :.||.:||...|||.||:||| ::.:.:.|:|      .|...|..:..|..|:.:.||.|::|.
  Fly   215 TRELAKRLEGSGVTVNALHPG-VVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYA 278

Human   363 AAVPELEGLGGMYFNNCCRCMPSPEAQ---SEETARTLWALSER 403
            |..|||:.:.|:||::   |.|.|.|.   .::.|:.|||.||:
  Fly   279 ALDPELKNISGLYFSD---CKPKPVASGALDDKVAKFLWAESEK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WWOXNP_057457.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
WW 18..47 CDD:459800
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 120/289 (42%)
Interaction with MAPT. /evidence=ECO:0000250 125..414 119/288 (41%)
Mediates targeting to the mitochondria. /evidence=ECO:0000250 209..273 30/63 (48%)
Rdh1NP_610310.2 Rossmann-fold NAD(P)(+)-binding proteins 43..317 CDD:473865 118/285 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.