DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLK and Cdk1

DIOPT Version :10

Sequence 1:NP_057315.3 Gene:NLK / 51701 HGNCID:29858 Length:527 Species:Homo sapiens
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:302 Identity:107/302 - (35%)
Similarity:164/302 - (54%) Gaps:26/302 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   137 DIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSAL 201
            |.|....||.|.:|||:...:...|:.||:||:.....:........||:.:|...||:|::...
  Fly     3 DFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLE 67

Human   202 DILQPPHIDYFEEIYVVTELMQSDLHKIIVS---PQPLSSDHVKVFLYQILRGLKYLHSAGILHR 263
            |:|...:     .||::.|.:..||.|.:.|   .:.:.|:.|:.:||||...:.:.|...:|||
  Fly    68 DVLMEEN-----RIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHR 127

Human   264 DIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVG 328
            |:||.|||::.:.::|:.||||.|...: ..|..|.|:||.:|||||:|:||..||..:||||:|
  Fly   128 DLKPQNLLIDKSGLIKVADFGLGRSFGI-PVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIG 191

Human   329 CIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLS 393
            |||||:..|:.|||..|.|.||..:..:|.||:        |.....:...|..:.:.|...|  
  Fly   192 CIFAEMATRKPLFQGDSEIDQLFRMFRILKTPT--------EDIWPGVTSLPDYKNTFPCWST-- 246

Human   394 SQATHE-------AVHLLCRMLVFDPSKRISAKDALAHPYLD 428
            :|.|::       .:.|:.:||::||..||||||.|.|||.:
  Fly   247 NQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLKNP_057315.3 Required for interaction with TAB2. /evidence=ECO:0000250|UniProtKB:O54949 1..304 54/169 (32%)
Sufficient for interaction with DAPK3. /evidence=ECO:0000269|PubMed:21454679 1..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..140 1/2 (50%)
Sufficient for interaction with DAPK3. /evidence=ECO:0000269|PubMed:21454679 124..416 97/288 (34%)
STKc_NLK 137..508 CDD:173748 107/302 (35%)
TQE 298..300 1/1 (100%)
Required for homodimerization and kinase activation and localization to the nucleus. /evidence=ECO:0000250|UniProtKB:O54949 428..527 0/1 (0%)
Required for interaction with TAB2. /evidence=ECO:0000250|UniProtKB:O54949 434..527
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 106/299 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.