DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5MC2 and VhaPPA1-1

DIOPT Version :9

Sequence 1:XP_016874949.1 Gene:ATP5MC2 / 517 HGNCID:842 Length:198 Species:Homo sapiens
Sequence 2:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster


Alignment Length:215 Identity:48/215 - (22%)
Similarity:79/215 - (36%) Gaps:60/215 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     4 LILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTP 68
            |.|.||..|::...:.|.|...:...|.:|  |.|....|.|.....:    |.:...:..:.|.
  Fly    16 LFLAVATILTLYFVMTGKGERVSVGWFLAS--SNPYMWACLGIGLSVS----LSVVGAALGIHTT 74

Human    69 SLVKSTSQLLSRPLSAVV---LKRPEILTDESLS-----SLAVSCPLTSLVSSRSFQTSAISRDI 125
            .             :::|   :|.|.|.|...:|     ::|:...:|::|.|...:..::...:
  Fly    75 G-------------TSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLEQFSMETAL 126

Human   126 DTAA----------KFIGAGAA----------TVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLF 170
            ..||          ...|||.|          .||:.||||.:..         |.|.:|..::.
  Fly   127 SQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSD---------AANAALFVKIL 182

Human   171 SYAILGFALSEAMGLFCLMV 190
            ...|.|    .|:|||.|:|
  Fly   183 IVEIFG----SAIGLFGLIV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5MC2XP_016874949.1 ATP9 124..198 CDD:164765 23/87 (26%)
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 12/78 (15%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.