DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP5MC2 and Vha16-5

DIOPT Version :9

Sequence 1:XP_016874949.1 Gene:ATP5MC2 / 517 HGNCID:842 Length:198 Species:Homo sapiens
Sequence 2:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster


Alignment Length:182 Identity:43/182 - (23%)
Similarity:68/182 - (37%) Gaps:44/182 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    56 LKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKR-PEILTDESLSSLAVSCPLTS-------LVS 112
            |.::..|..|..|.|::|. :|....:|.:||.| |.......:..:..|..|||       .||
  Fly     7 LPVYNGSNSVDVPGLIESL-KLKETSISPIVLDRYPPYSPFYGVMGVVFSSVLTSAGAAYGTAVS 70

Human   113 SRSFQTSAISRD---IDTAAKFIGAG-----AATVGVAGSG------------------AGIGTV 151
            ......:|:.|.   :.:....:.||     ...|.|..||                  ||:...
  Fly    71 GTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSVLLSGELAPAPKYSLPTGYVHLAAGLSVG 135

Human   152 FGSLIIGYA---------RNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 194
            |..|..|||         |:.:|:.:||...||....:|.:||:.|::...:
  Fly   136 FAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILILIFAEVLGLYGLIIGIYL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP5MC2XP_016874949.1 ATP9 124..198 CDD:164765 23/106 (22%)
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 21/106 (20%)
ATP-synt_C 127..187 CDD:278563 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.