DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS29 and Vps29

DIOPT Version :10

Sequence 1:NP_001269079.1 Gene:VPS29 / 51699 HGNCID:14340 Length:214 Species:Homo sapiens
Sequence 2:NP_608575.1 Gene:Vps29 / 33295 FlyBaseID:FBgn0031310 Length:182 Species:Drosophila melanogaster


Alignment Length:180 Identity:151/180 - (83%)
Similarity:169/180 - (93%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    34 LVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDEN 98
            ||||||||||||||:|||||||||||||:|.|||.|||:||||||||||:||.||||||||||||
  Fly     2 LVLVLGDLHIPHRCSSLPAKFKKLLVPGRIHHILATGNICTKESYDYLKSLANDVHIVRGDFDEN 66

Human    99 LNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYIN 163
            |.||||||||||||:|||.|||||:|.||..:|||:|||.||||||:|||:||||:||.||||||
  Fly    67 LTYPEQKVVTVGQFRIGLCHGHQVVPRGDPEALALIQRQLDVDILITGHTYKFEAYEHGNKFYIN 131

Human   164 PGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKK 213
            |||||||:|.|:||::|||||||||::||||||||||||:||||||||||
  Fly   132 PGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQLIGDEVKVERIEYKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS29NP_001269079.1 MPP_Vps29 34..211 CDD:163637 147/176 (84%)
Vps29NP_608575.1 MPP_Vps29 2..179 CDD:163637 147/176 (84%)

Return to query results.
Submit another query.