DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP7 and Fkbp59

DIOPT Version :10

Sequence 1:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens
Sequence 2:NP_524895.2 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster


Alignment Length:170 Identity:55/170 - (32%)
Similarity:82/170 - (48%) Gaps:27/170 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    47 SKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKV 111
            ::|...|..::.||.|.|. ||::|..|.::||  |..|.||.|.|||..|:.:..|..||:..:
  Fly    26 TETPHSGCTVSLHYTGRLV-DGTEFDSSLSRNE--PFEFSLGKGNVIKAFDMGVATMKLGERCFL 87

Human   112 VIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQR 176
            ...|::|||..| :...||||||||||:|:.    |.:..:.....|...||.:.:|.       
  Fly    88 TCAPNYAYGAAG-SPPAIPPDATLIFELEML----GWKGEDLSPNQDGSIDRTILEAS------- 140

Human   177 EFEKDEKPRD---------KSYQDAVLEDIFKKNDHDGDG 207
              :|...|.|         .|::..|.||...:.|: |:|
  Fly   141 --DKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDY-GEG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP7NP_851939.1 FKBP_C 46..141 CDD:459735 39/93 (42%)
FRQ1 <127..213 CDD:444056 26/90 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222 3/8 (38%)
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222
Fkbp59NP_524895.2 FKBP_C 25..117 CDD:459735 40/94 (43%)
SlpA 147..>210 CDD:440668 8/32 (25%)
NlpI <245..402 CDD:443815
TPR repeat 252..280 CDD:276809
TPR repeat 296..326 CDD:276809
TPR repeat 331..359 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.