DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMX2 and CstF64

DIOPT Version :10

Sequence 1:NP_057108.2 Gene:RBMX2 / 51634 HGNCID:24282 Length:322 Species:Homo sapiens
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:104 Identity:38/104 - (36%)
Similarity:65/104 - (62%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    22 VADKVSWHSEY-KDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYE 85
            :|||....|.. |....:|:|.:|||.||..:..:||:.|.::::.||.|:::||.|||.|..|:
  Fly     1 MADKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYK 65

Human    86 DQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEI 124
            ||.:.:.|:.|.||.:|.|||:|||:....::..:.:::
  Fly    66 DQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMX2NP_057108.2 RRM_ist3_like 27..115 CDD:409845 35/88 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..322
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 34/83 (41%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.