DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDGFRB and Cad96Ca

DIOPT Version :9

Sequence 1:NP_002600.1 Gene:PDGFRB / 5159 HGNCID:8804 Length:1106 Species:Homo sapiens
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:370 Identity:124/370 - (33%)
Similarity:181/370 - (48%) Gaps:87/370 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   593 WELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSH 657
            ||.||.:|.....||.||||||....|..::.::....||||.||.:|...:::.|:|||::|..
  Fly   463 WEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMKS 527

Human   658 LGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNALPV 722
            |.||:|||:|||.||...|.::|.||...|.|..||..::   .:.|           |.|    
  Fly   528 LEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSR---AERH-----------YGN---- 574

Human   723 GLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPSAPERTC 787
                 :|                                                          
  Fly   575 -----TH---------------------------------------------------------- 576

Human   788 RATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIM 852
                 .:|.||:..||..|.||||.||::|.|:..:||||||||:||.:....|:.|||.|||::
  Fly   577 -----GKSNVLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVI 636

Human   853 RDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAI 917
            ....|..|....||::|||.||:::::::..||:||||||:|||.|||.||||.:...: ....:
  Fly   637 TSKIYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAAD-VMRKV 700

Human   918 KRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLL 962
            :.|||:.:|.|...|:|.||..||....:.||.|::::.:|::||
  Fly   701 RDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDGFRBNP_002600.1 ig 37..114 CDD:278476
IG 40..110 CDD:214652
IG_like 222..310 CDD:214653
Ig1_PDGFR-alphabeta 228..312 CDD:143269
Ig4_PDGFR-alpha 314..415 CDD:143267
Ig 425..523 CDD:299845
PTKc_PDGFR_beta 562..953 CDD:133238 121/359 (34%)
Pkinase_Tyr 600..953 CDD:285015 117/352 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1019..1106
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 117/357 (33%)
PTKc 474..742 CDD:270623 116/354 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.