DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDGFRB and CG3277

DIOPT Version :10

Sequence 1:NP_002600.1 Gene:PDGFRB / 5159 HGNCID:8804 Length:1106 Species:Homo sapiens
Sequence 2:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster


Alignment Length:76 Identity:20/76 - (26%)
Similarity:31/76 - (40%) Gaps:15/76 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   821 VSLHPLYQSKL---YPPAKSLLHPQ-TLSHADCLTPGSFSHL----SSFSVRDEQEKSP------ 871
            :.:..|:.|:|   |....||:.|. .|:.|.|:...:.:.|    ..:..|.|.|..|      
  Fly   134 LEMKELFDSELKEVYACVGSLVAPNVALTVAHCVINKTSTRLLVRAGEWDTRTESEVLPYQDARV 198

Human   872 -TLLSQDTYNK 881
             .:|..|.|||
  Fly   199 KEVLIHDRYNK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDGFRBNP_002600.1 ig 37..114 CDD:395002
Ig strand B 50..54 CDD:409353
Ig strand C 60..63 CDD:409353
Ig strand E 83..87 CDD:409353
Ig strand F 97..101 CDD:409353
IgI_PDGFR-alphabeta 212..311 CDD:409447
Ig strand A 212..216 CDD:409447
Ig strand A' 223..227 CDD:409447
Ig strand B 229..238 CDD:409447
Ig strand C 243..248 CDD:409447
Ig strand C' 251..253 CDD:409447
Ig strand D 257..265 CDD:409447
Ig strand E 270..278 CDD:409447
Ig strand F 288..294 CDD:409447
Ig strand G 299..305 CDD:409447
Ig4_PDGFR 314..415 CDD:409445
Ig 431..519 CDD:472250
Ig strand B 432..436 CDD:409353
Ig strand C 445..449 CDD:409353
Ig strand E 493..497 CDD:409353
Ig strand F 504..510 CDD:409353
PTKc_PDGFR_beta 562..953 CDD:133238 20/76 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1019..1106
CG3277NP_608762.3 PTKc 430..763 CDD:270623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.