DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDGFRL and drpr

DIOPT Version :9

Sequence 1:NP_001359002.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:239 Identity:40/239 - (16%)
Similarity:68/239 - (28%) Gaps:91/239 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    25 PKNKRPKEP-----GENRIKPTNKKVKPKIPKMKDR--------DSANSAPKTQSIMMQVLDKGR 76
            |.|.....|     .|.|:.|.|  ::.|:.....|        |..|::.:..|..:      .
  Fly   848 PPNHNFDNPVYGMQAETRLLPNN--MRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSI------N 904

Human    77 FQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRL--SVKQNERYGQLTLVNSTSADTG 139
            :.....|.:|.|.:|..:            .|.::.|:..:  .:|..|.|              
  Fly   905 YNHDLLTKNLNADRTNPI------------VYNESLKEEHVYDEIKHKEGY-------------- 943

Human   140 EFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAK 204
                           ||..|..|..:|         |...|..:.|..|.           .|.|
  Fly   944 ---------------KDPVKIYSKILF---------PEDEYDHLDYSRPS-----------TSQK 973

Human   205 VTLHREFPA-------KEIPANGTDIVYDMKRGFVYLQPHSEHQ 241
            ...||...|       :|.|:|..::...:.:.....:|..:|:
  Fly   974 PHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHE 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDGFRLNP_001359002.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64 11/51 (22%)
IG_like 83..145 CDD:214653 9/63 (14%)
Ig 293..372 CDD:386229
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.