DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB6B and rab6ba

DIOPT Version :9

Sequence 1:NP_057661.3 Gene:RAB6B / 51560 HGNCID:14902 Length:208 Species:Homo sapiens
Sequence 2:XP_005165989.1 Gene:rab6ba / 558900 ZFINID:ZDB-GENE-050809-136 Length:258 Species:Danio rerio


Alignment Length:208 Identity:199/208 - (95%)
Similarity:204/208 - (98%) Gaps:0/208 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 65
            ||.|.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish    51 MSVGNDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 115

Human    66 LWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDL 130
            ||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||
Zfish   116 LWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDL 180

Human   131 ADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDK 195
            |||||||||||||||||||||||||||||||||||||||||:||||||::||.||||||||||||
Zfish   181 ADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVAAALPGMESMQETSKEGMIDIKLDK 245

Human   196 PQEPPASEGGCSC 208
            |||||.:||||||
Zfish   246 PQEPPTTEGGCSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB6BNP_057661.3 Rab6 14..174 CDD:206654 157/159 (99%)
Effector region. /evidence=ECO:0000250 42..50 7/7 (100%)
rab6baXP_005165989.1 Rab6 64..224 CDD:206654 157/159 (99%)
RAB 64..221 CDD:197555 155/156 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194326542
Domainoid 1 1.000 302 1.000 Domainoid score I7433
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39749
Inparanoid 1 1.050 391 1.000 Inparanoid score I8035
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - oto44891
orthoMCL 1 0.900 - - OOG6_100976
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1515.300

Return to query results.
Submit another query.