DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDGFRA and Cad96Ca

DIOPT Version :9

Sequence 1:NP_001334757.1 Gene:PDGFRA / 5156 HGNCID:8803 Length:1114 Species:Homo sapiens
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:417 Identity:133/417 - (31%)
Similarity:199/417 - (47%) Gaps:110/417 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   610 RWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMT 674
            ||||||..|....:||.||||:|....|..::.::.:..||||.||.:|...:::.|:|||::|.
  Fly   462 RWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMK 526

Human   675 HLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPAD 739
            .|.||:|:|:|||.||...|.::|.||...|.|..||..:|                        
  Fly   527 SLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSR------------------------ 567

Human   740 ESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVK 804
             :.|.|                                                           
  Fly   568 -AERHY----------------------------------------------------------- 572

Human   805 NLLSDDNSEG----LTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA 865
                 .|:.|    ||..||.||.||||:||::|.|:..:||||||||:|:......|:.|||.|
  Fly   573 -----GNTHGKSNVLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFA 632

Human   866 RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTF 930
            ||::....|..|....||::|||.||::||:::..||:||:|||:|||.:||.|||||:.. :..
  Fly   633 RDVITSKIYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADV 696

Human   931 YNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFL 995
            ..|::.|||:.||:|...|:|.||..||:.:|::||.|..:.::::.||         ...:|::
  Fly   697 MRKVRDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL---------HTEMDYI 752

Human   996 KSDHPAVARMRVDSDNAYIGVTYKNEE 1022
            :.:       |....|.|..|:...|:
  Fly   753 ELE-------RFPDHNYYNIVSLSGEK 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDGFRANP_001334757.1 None
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 119/360 (33%)
PTKc 474..742 CDD:270623 118/357 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.