DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDGFRA and drpr

DIOPT Version :9

Sequence 1:NP_001334757.1 Gene:PDGFRA / 5156 HGNCID:8803 Length:1114 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:259 Identity:55/259 - (21%)
Similarity:87/259 - (33%) Gaps:98/259 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   870 HDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFY-NK 933
            ||:|         |..| .|...|||                        |..||..::... |.
  Fly   840 HDTN---------PPSW-PPNHNFDN------------------------PVYGMQAETRLLPNN 870

Human   934 IKSGYRMAKPD-------------HATSEV--------YEIMVKCWNSEPEKRPSFYHLSEIVEN 977
            ::|  :|...|             :|:..|        ::::.|..|:: ...|..|:.|...|:
  Fly   871 MRS--KMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNAD-RTNPIVYNESLKEEH 932

Human   978 LL-----PGQYK---KSYEKI--------HLDFLK---SDHPAVARMRVDSDNAYIGVTYKNEE- 1022
            :.     ...||   |.|.||        |||:.:   |..|...||    ::|.:.:....|: 
  Fly   933 VYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRM----NDAMLNINQDEEKP 993

Human  1023 DKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIK 1086
            ..:|:....|::           |||..:|.|:.|.....|.:....|..|.    |||..|:|
  Fly   994 SNVKNMTVLLNK-----------PLPPTEPEPQHECFDNTNTNLDNVSTASP----SSSPKFLK 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDGFRANP_001334757.1 None
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.