DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CINP and CG34174

DIOPT Version :9

Sequence 1:NP_116019.1 Gene:CINP / 51550 HGNCID:23789 Length:212 Species:Homo sapiens
Sequence 2:NP_001097057.1 Gene:CG34174 / 5740699 FlyBaseID:FBgn0085203 Length:217 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:78/194 - (40%) Gaps:30/194 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    13 KPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENE 77
            |..|....::::||.|       ||:..:..|.:....|...|...|.|.:.|..|.        
  Fly    45 KTRLETIVKQLQDNYA-------KWQLAHQRGTSICYTIEAKKTKCLEKSQDEGSSL-------- 94

Human    78 EKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFH-TWP 141
                  |.::|...|.:|.........|....:::....:||.:|..      |....:|: :|.
  Fly    95 ------YPDDLLLPCNKLAIIASIFGDIANNTKEILRQLRGILKLPG------SAADTIFYRSWK 147

Human   142 TTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLL 205
            ...|...:.:|.|.|.||.|:|..||..:||:.:....:::.::|....:|  ||.:||..:||
  Fly   148 LQQFVVFAKELSERYEKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHV--DSYVHLGFLLL 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CXWD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408353at2759
OrthoFinder 1 1.000 - - FOG0009694
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.