DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and CG31156

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_651070.3 Gene:CG31156 / 42669 FlyBaseID:FBgn0051156 Length:948 Species:Drosophila melanogaster


Alignment Length:72 Identity:17/72 - (23%)
Similarity:40/72 - (55%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    45 VAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSM 109
            |..||.:|||:.: |..:.||:|.::|::.:       :.|||::...::..::|..::::.|..
  Fly   877 VTNVTQFGAFVDV-GVERNGLIHNSNMNNSQ-------LSVGDRIVASVVKVDLKRRQLELRLEN 933

Human   110 KVVNQGT 116
            .::...|
  Fly   934 MLMETDT 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191 15/62 (24%)
CG31156NP_651070.3 Tex 184..932 CDD:441786 15/62 (24%)

Return to query results.
Submit another query.