DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and pea

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster


Alignment Length:225 Identity:65/225 - (28%)
Similarity:96/225 - (42%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    17 RLCSLNL-PFSAEGADSKGWEAGPESPAVVAMVTDYGAFIKIPGCRK--QGLVHRTHM-SSCRVD 77
            |.||..: |.||...|..  |||......:|.:..:|.|:::.|.||  :||||.:.: :..||.
  Fly   265 RDCSEKMPPPSAAMTDDP--EAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVT 327

Human    78 KPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG 142
            ..:|:|.....|.||:    |.....|||||||.|:|.:||||:|.:...|.:|..|....|  |
  Fly   328 DVTEVVTRNQTVKVKV----MSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPD--G 386

Human   143 QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTR--NPS 205
            ...:..::||                 :|..|.:    .||.|.::..          ||  :|.
  Fly   387 PFSSSTSMLN-----------------LQGNGME----GDEHESRKRV----------TRISSPE 420

Human   206 RKRKKEKKKKKHRDRKSSDSDSSDSESDTG 235
            |...|:.......||    |:..|.:.:||
  Fly   421 RWEIKQMISSGVLDR----SEMPDFDEETG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191 21/65 (32%)
peaNP_610928.1 GH2-like_DHX8 7..74 CDD:409668
S1_DHX8_helicase 285..363 CDD:240189 28/81 (35%)
HrpA 578..>1203 CDD:441249
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.