DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and mle

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_476641.1 Gene:mle / 35523 FlyBaseID:FBgn0002774 Length:1293 Species:Drosophila melanogaster


Alignment Length:68 Identity:16/68 - (23%)
Similarity:34/68 - (50%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    62 KQGLVHRT--HMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGK-DLDPN 123
            |..|:|:|  :.|:..|..|......|:|:..:.:..:    ::.:...::|:..|:.| ||..|
  Fly  1027 KAALLHKTSVNCSNLAVTFPYPFFVFGEKIRTRAVSCK----QLSMVSPLQVILFGSRKIDLAAN 1087

Human   124 NVI 126
            |::
  Fly  1088 NIV 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191 9/47 (19%)
mleNP_476641.1 DSRM_DHX9_rpt1 2..70 CDD:380683
DSRM_DHX9_rpt2 167..241 CDD:380684
DEXHc_DHX9 326..559 CDD:350730
HrpA 378..>889 CDD:441249
OB_NTP_bind 1002..1079 CDD:400182 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.