DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and l(2)37Cb

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_609946.1 Gene:l(2)37Cb / 35192 FlyBaseID:FBgn0086444 Length:894 Species:Drosophila melanogaster


Alignment Length:115 Identity:25/115 - (21%)
Similarity:47/115 - (40%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   171 QPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRN-----PSRKRKKEKKKK---KHRDR------- 220
            :|...:.|.:.|.:|..|.|...:....|.|||     ..|:..:|..|:   :|.||       
  Fly    18 EPDSEEESRLKDLQERDEFASRLKKRDDDRTRNVVDSTGGRRAIEEATKRLKLEHEDRDKIVPHL 82

Human   221 ----------KSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKK 260
                      |..|...::.|:|. ....:...:|...|::|:::::||:
  Fly    83 RLQSRRQYLEKRKDDKVAELEADI-LDDEYLFDESVLTKREKEEREYKKQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191
l(2)37CbNP_609946.1 PTZ00121 <6..267 CDD:173412 25/115 (22%)
HrpA 251..>868 CDD:441249
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.