DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and spdo

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_733372.1 Gene:spdo / 318559 FlyBaseID:FBgn0260440 Length:565 Species:Drosophila melanogaster


Alignment Length:100 Identity:14/100 - (14%)
Similarity:40/100 - (40%) Gaps:37/100 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   201 TRNPSRKRKKEKKKKKHR---------DRKSSDSDSSD--------SESDTGKRARHTSKDSKAA 248
            ||:.:||:.:::::::|:         .::.....||.        .|.::.:.:|:.....:||
  Fly    64 TRSVTRKQHQQQQQQQHQQQIHQQHLAQQQQHQPQSSSGRYALVPLEELNSSRASRYAIVPGQAA 128

Human   249 KKKKKKKK--------------------HKKKHKE 263
            ::..:.:.                    |::.|:|
  Fly   129 QRLARSQDNLDRYGSRHGLHEEEEPHSFHEEPHQE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191
spdoNP_733372.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.