DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and kz

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_476591.1 Gene:kz / 31205 FlyBaseID:FBgn0001330 Length:1192 Species:Drosophila melanogaster


Alignment Length:164 Identity:38/164 - (23%)
Similarity:65/164 - (39%) Gaps:42/164 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    87 DKV-WVKLIGREMKNDRIKVSLSMKVVNQGTGKDL-DPNNVIIEQEE---------------RRR 134
            ||| .||::.::.:. .::..:..|...:|..:.| |...|.|.:||               :|.
  Fly    61 DKVQHVKILSKKQRK-HLQAIVDKKKKKEGRAQLLGDLAAVQIPEEELQQYTSISQVQTVGLKRL 124

Human   135 RSFQDYTGQKITLEA-VLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKP 198
            .:..:|..:|...:| ||.......|.:.:..|       |:|..|:.:||||.:..:       
  Fly   125 PTLDEYLAKKKERQAQVLAEKSSASGLRVNAIK-------GSKRKLLVEEEEELQAKR------- 175

Human   199 DPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSES 232
               :||:....:|.      |..||.||..|.|:
  Fly   176 ---KNPNVISVEED------DEDSSSSDEDDEEA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191 5/21 (24%)
kzNP_476591.1 HrpA 260..>1071 CDD:441249
DEXHc_DHX37 260..439 CDD:350740
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.