DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCCHC17 and npp106

DIOPT Version :10

Sequence 1:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens
Sequence 2:NP_588422.1 Gene:npp106 / 2539077 PomBaseID:SPCC1739.14 Length:933 Species:Schizosaccharomyces pombe


Alignment Length:62 Identity:17/62 - (27%)
Similarity:31/62 - (50%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    92 KLIGREMKNDRIKV--SLSMKVVNQGTGKDLDPNNVIIEQEER-RRRSFQDYTGQKITLEAV 150
            ||.|:|..::.:::  .|.:..:|: ...:.:||..|.....| |||:|:..|.|...|..:
pombe   804 KLYGQEKWDEVLQLIEHLDLLPINE-VQAEFEPNEQIPPISARLRRRAFEFSTFQDEVLSVI 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191 4/17 (24%)
npp106NP_588422.1 Nic96 288..924 CDD:461172 17/62 (27%)

Return to query results.
Submit another query.