DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHF7 and pie

DIOPT Version :9

Sequence 1:NP_001308055.1 Gene:PHF7 / 51533 HGNCID:18458 Length:381 Species:Homo sapiens
Sequence 2:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster


Alignment Length:373 Identity:110/373 - (29%)
Similarity:175/373 - (46%) Gaps:54/373 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    33 CWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKI 97
            |.:|.....|....||::...|:.||||||:||:.|||||..:.|..|||..||::|||.|.::.
  Fly     9 CLICKYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHLPQRGGDSSGILGFLLRDIREEAAAAEKRK 73

Human    98 CFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSFCDKHRP----TQNIQHGHVGEE 158
            |:.|.|.||::.|  |:|...|||.||.|...:.:|.|:|||:|.|.||    .:.:|.......
  Fly    74 CWYCNKIGASLQC--DRCRSLFHLKCGLENRAVFEFCGQYKSYCYKCRPMDDYKRQLQSNPPRNA 136

Human   159 SCILCCEDLSQQSVE-NIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEFPQEMLRMGI 222
            :|.:|...:.:..:. .:...||.....|:||:::||.||. ::.:|..|.:.: |...:....:
  Fly   137 TCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSG-YYLRCIWCRSER-FRDSIRLQSV 199

Human   223 HIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDC-- 285
            .:|||||.||.:..|:.:|::|...||.|.||...||.  .:...|.::.|::|.:...|..|  
  Fly   200 FVPDRDATWEKQRNAYRELHERNLKCDQPNCLCPSGRT--YNRLSWVILCCSSCAATSAHLKCLV 262

Human   286 SSLRSNSKK----WECEEC---------SPAAATD--------------YIPENSGDIPCCSST- 322
            .:||...|:    ::|..|         .||..|:              |:.:...|....|.| 
  Fly   263 GALRLPKKRERTDFKCSMCLDVERRIAEGPARTTEETNADGDNQVDGSFYVQKLGPDAATRSLTQ 327

Human   323 ---FHPEEH----------FCRDNTLEENPGLSWTDWPEPSLLEKPES 357
               |..|:.          |.:..:...:..||.:...|..::|.|:|
  Fly   328 TPVFSEEDESERSSNITVIFSQPKSNATSERLSLSPPQEEMIVEIPDS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHF7NP_001308055.1 ePHD_PHF7_G2E3_like 33..144 CDD:277139 49/110 (45%)
PHD_PHF7_G2E3_like 247..300 CDD:276971 16/58 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..363 6/17 (35%)
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 49/109 (45%)
PHD_SF 224..>260 CDD:304600 11/37 (30%)
PARM 318..>491 CDD:293666 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141434
Domainoid 1 1.000 93 1.000 Domainoid score I7551
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110264at33208
OrthoFinder 1 1.000 - - FOG0003998
OrthoInspector 1 1.000 - - otm41254
orthoMCL 1 0.900 - - OOG6_106451
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3283
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.700

Return to query results.
Submit another query.