DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANAPC11 and Roc1b

DIOPT Version :10

Sequence 1:NP_001002244.1 Gene:ANAPC11 / 51529 HGNCID:14452 Length:196 Species:Homo sapiens
Sequence 2:NP_652613.1 Gene:Roc1b / 53445 FlyBaseID:FBgn0040291 Length:122 Species:Drosophila melanogaster


Alignment Length:33 Identity:12/33 - (36%)
Similarity:15/33 - (45%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     5 IKCWNGVATWLWVANDENCGICRMAFNGCCPDC 37
            :|.|...|.|.|....:||.|||......|.:|
  Fly    39 VKKWVAHAMWGWDVAVDNCAICRNHIMNLCIEC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANAPC11NP_001002244.1 RING_Ubox 1..>51 CDD:473075 12/33 (36%)
Roc1bNP_652613.1 mRING-H2-C3H2C2D_RBX1 55..115 CDD:438148 7/17 (41%)

Return to query results.
Submit another query.